Zepter.rs valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Zepter |
| Description | N/A |
| Keywords | N/A |
Server Information
| WebSite | |
| Host IP | 18.156.174.36 |
| Location | Frankfurt am Main, Hesse, Germany |
Related Websites
| Site | Rank |
| zepter.com | #766,675 |
| zepter.hr | #7,169,640 |
More to Explore
| zepter.ru |
| zeytindostu.org.tr |
| netlog.com |
| pprct.net |
| horchow.com |
| essayswriting.org |
| prokatmedia.ru |
| ojk888.com |
| kliniklab.com |
| kerimyapiasmatavansistemleri.com |
| meujeitocarmem.com.br |
| mexico-insights.com |
Zepter.rs Valuation
|
US$21,082
Last updated: Dec 12, 2020
Zepter.rs has global traffic rank of 1,620,521 and ranks the 4,789th in Serbia. Zepter.rs has an estimated worth of US$ 21,082, based on its estimated Ads revenue. Zepter.rs receives approximately 1,925 unique visitors each day. Its web server is located in Frankfurt am Main, Hesse, Germany, with IP address 18.156.174.36. According to SiteAdvisor, zepter.rs is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$21,082 |
| Daily Ads Revenue | US$11 |
| Monthly Ads Revenue | US$346 |
| Yearly Ads Revenue | US$4,216 |
| Daily Unique Visitors | 1,925 |
| Note: All traffic and earnings values are estimates. | |
Traffic Ranks
| Global Rank | 1,620,521 |
| Delta (90 Days) | 0 |
| Most Popular In Country | Serbia |
| Country Rank | 4,789 |
DNS Records
| Host | Type | TTL | Data |
| zepter.rs | A | 299 | IP: 195.12.33.39 |
| zepter.rs | MX | 299 | Priority: 10 Target: mail2.zepter.rs. |
| zepter.rs | NS | 21599 | Target: dns3.orion.rs. |
| zepter.rs | NS | 21599 | Target: dns2.orion.rs. |
| zepter.rs | NS | 21599 | Target: dns1.orion.rs. |
| zepter.rs | NS | 21599 | Target: dns4.orion.rs. |
| zepter.rs | TXT | 299 | TXT: jnjht3h99vbr0v1rdlh8agaj8o |
| zepter.rs | TXT | 299 | TXT: v=spf1 mx a ip4:178.253.247.36 ip4:5.9.8.183 ip4:178.253.247.35 -all |
| zepter.rs | SOA | 21599 | MNAME: dns1.orion.rs. RNAME: admin-zepterdns.sezamhosting.com. Serial: 2019092505 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
HTTP Headers
HTTP/1.1 301 Moved Permanently Content-Type: text/html; charset=UTF-8 Location: https://www.zepter.rs/ Server: Microsoft-IIS/8.5 X-Powered-By: ASP.NET Access-Control-Allow-Origin: * Date: Mon, 25 Nov 2019 18:16:22 GMT Content-Length: 145 HTTP/1.1 200 OK Cache-Control: no-cache, must-revalidate Pragma: no-cache Transfer-Encoding: chunked Content-Type: text/html; charset=utf-8 Expires: -1 Server: Microsoft-IIS/8.5 X-Frame-Options: SAMEORIGIN Set-Cookie: CMSPreferredCulture=sr-Latn-CS; expires=Wed, 25-Nov-2020 18:16:23 GMT; path=/; HttpOnly Set-Cookie: CMSCsrfCookie=G/Q9ld6Wrpb16yqxPZjTFMSzn4VAjkTgswEu+GnL; path=/; HttpOnly X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Access-Control-Allow-Origin: * Date: Mon, 25 Nov 2019 18:16:22 GMT |
Zepter.rs Whois Information
Domain name: zepter.rs Domain status: Active Registration date: 10.03.2008 15:41:36 Modification date: 07.03.2018 07:40:03 Expiration date: 10.03.2021 15:41:36 Registrar: ORION TELEKOM d.o.o. DNS: dns1.orion.rs - 77.105.36.77 DNS: dns2.orion.rs - 77.105.37.77 DNS: dns3.orion.rs - 169.60.35.162 DNS: dns4.orion.rs - 114.111.129.149 Registrant: ZEPTER INTERNATIONAL DOO BEOGRAD Address: BULEVAR MIHAJLA PUPINA 117, Beograd, Serbia ID Number: 07465424 Tax ID: 100000400 Administrative contact: Individual Technical contact: Individual |